PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G09460.1
Common NameAtMYB6, MYB6, T15G18.120
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 236aa    MW: 26473.7 Da    PI: 8.4808
Description myb domain protein 6
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G09460.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.62.8e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++lvd+++ +G g+W++ ++  g+ R++k+c++rw +yl
      AT4G09460.1 14 KGAWTKEEDQRLVDYIRNHGEGCWRSLPKSAGLLRCGKSCRLRWINYL 61
                     79******************************99************97 PP

2Myb_DNA-binding569.2e-1867111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++T +Ed+++++++ +lG++ W++Ia +++ gRt++++k++w+++
      AT4G09460.1  67 RGNFTDDEDQIIIKLHSLLGNK-WSLIAGRLP-GRTDNEIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.6E-24564IPR009057Homeodomain-like
PROSITE profilePS5129416.76961IPR017930Myb domain
SMARTSM007174.5E-131363IPR001005SANT/Myb domain
SuperFamilySSF466893.95E-2913108IPR009057Homeodomain-like
PfamPF002493.5E-161461IPR001005SANT/Myb domain
CDDcd001677.85E-111661No hitNo description
PROSITE profilePS5129428.21162116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-2765116IPR009057Homeodomain-like
SMARTSM007171.1E-1666114IPR001005SANT/Myb domain
PfamPF002496.7E-1667111IPR001005SANT/Myb domain
CDDcd001674.59E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0090378Biological Processseed trichome elongation
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001017developmental stageM germinated pollen stage
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 236 aa     Download sequence    Send to blast
MGRSPCCEKA HTNKGAWTKE EDQRLVDYIR NHGEGCWRSL PKSAGLLRCG KSCRLRWINY  60
LRPDLKRGNF TDDEDQIIIK LHSLLGNKWS LIAGRLPGRT DNEIKNYWNT HIKRKLLSHG  120
IDPQTHRQIN ESKTVSSQVV VPIQNDAVEY SFSNLAVKPK TENSSDNGAS TSGTTTDEDL  180
RQNGECYYSD NSGHIKLNLD LTLGFGSWSG RIVGVGSSAD SKPWCDPVME ARLSLL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-30141167108B-MYB
1h8a_C3e-301311626128MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.42180.0floral meristem| flower
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO306810830.0
Genevisible255037_at0.0
Expression AtlasAT4G09460-
AtGenExpressAT4G09460-
ATTED-IIAT4G09460-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, stems, flower buds, and siliques. {ECO:0000269|PubMed:9839469}.
Functional Description ? help Back to Top
Source Description
TAIREncodes myb6 DNA-binding protein.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G09460.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By ethylene, asbscisic acid (ABA), auxin (IAA), and Pseudomonas syringae pv. phaseolica. {ECO:0000269|PubMed:9839469}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDabscisic acid, auxin, ethylene, gibberellin, jasmonic acid, salicylic acid
Interaction ? help Back to Top
Source Intact With
IntActSearch Q38851
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G09460
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankATU269360.0U26936.1 Arabidopsis thaliana clone myb6 DNA-binding protein mRNA, complete cds.
GenBankAY0868130.0AY086813.1 Arabidopsis thaliana clone 28019 mRNA, complete sequence.
GenBankAY5196040.0AY519604.1 Arabidopsis thaliana MYB transcription factor (At4g09460) mRNA, complete cds.
GenBankBT0041710.0BT004171.1 Arabidopsis thaliana clone RAFL15-40-D03 (R20880) putative myb family transcription factor (At4g09460) mRNA, complete cds.
GenBankBT0050850.0BT005085.1 Arabidopsis thaliana clone U20880 putative myb family transcription factor (At4g09460) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_192684.11e-176transcription repressor MYB6
SwissprotQ388511e-178MYB6_ARATH; Transcription repressor MYB6
TrEMBLR0HCS41e-158R0HCS4_9BRAS; Uncharacterized protein
STRINGAT4G09460.11e-176(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Kersten B, et al.
    Generation of Arabidopsis protein chips for antibody and serum screening.
    Plant Mol. Biol., 2003. 52(5): p. 999-1010
    [PMID:14558660]
  4. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  5. Leonhardt N, et al.
    Microarray expression analyses of Arabidopsis guard cells and isolation of a recessive abscisic acid hypersensitive protein phosphatase 2C mutant.
    Plant Cell, 2004. 16(3): p. 596-615
    [PMID:14973164]
  6. Goda H, et al.
    Comprehensive comparison of auxin-regulated and brassinosteroid-regulated genes in Arabidopsis.
    Plant Physiol., 2004. 134(4): p. 1555-73
    [PMID:15047898]
  7. Zimmermann IM,Heim MA,Weisshaar B,Uhrig JF
    Comprehensive identification of Arabidopsis thaliana MYB transcription factors interacting with R/B-like BHLH proteins.
    Plant J., 2004. 40(1): p. 22-34
    [PMID:15361138]
  8. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  9. Truman W,de Zabala MT,Grant M
    Type III effectors orchestrate a complex interplay between transcriptional networks to modify basal defence responses during pathogenesis and resistance.
    Plant J., 2006. 46(1): p. 14-33
    [PMID:16553893]
  10. Rowan DD, et al.
    Environmental regulation of leaf colour in red 35S:PAP1 Arabidopsis thaliana.
    New Phytol., 2009. 182(1): p. 102-15
    [PMID:19192188]
  11. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]
  12. Klopffleisch K, et al.
    Arabidopsis G-protein interactome reveals connections to cell wall carbohydrates and morphogenesis.
    Mol. Syst. Biol., 2011. 7: p. 532
    [PMID:21952135]
  13. Li SF,Parish RW
    Isolation of two novel myb-like genes from Arabidopsis and studies on the DNA-binding properties of their products.
    Plant J., 1995. 8(6): p. 963-72
    [PMID:8580966]
  14. Kranz HD, et al.
    Towards functional characterisation of the members of the R2R3-MYB gene family from Arabidopsis thaliana.
    Plant J., 1998. 16(2): p. 263-76
    [PMID:9839469]